PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G222200.1.p
Common NameGLYMA_19G222200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 496aa    MW: 55238.1 Da    PI: 7.2451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G222200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-1794141148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.19G222200.1.p  94 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 141
                          678*******************************************97 PP

2Myb_DNA-binding45.81.4e-14147190146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg +++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.19G222200.1.p 147 RGTFSQEEETLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 190
                          899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-2886144IPR009057Homeodomain-like
PROSITE profilePS5129418.92689141IPR017930Myb domain
SuperFamilySSF466892.38E-2992188IPR009057Homeodomain-like
SMARTSM007172.7E-1393143IPR001005SANT/Myb domain
PfamPF002493.8E-1594141IPR001005SANT/Myb domain
CDDcd001674.43E-1297141No hitNo description
PROSITE profilePS5129425.407142196IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-25145196IPR009057Homeodomain-like
SMARTSM007174.1E-13146194IPR001005SANT/Myb domain
PfamPF002492.1E-13147191IPR001005SANT/Myb domain
CDDcd001672.07E-9149189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MTSLMGPPSY INSTPFLSCH FIFLCSIHII SLALIFSLSQ SGSVPLLLTF HLQVPFNKPS  60
VNWKGSSPPH CFVGENPQYK MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV  120
PKQAGLQRCG KSCRLRWINY LRPDLKRGTF SQEEETLIIE LHAVLGNRWS QIAAQLPGRT  180
DNEIKNLWNS CLKKKLRQRG IDPVTHKPLS EVENGEEDKT RSQELSNELN LLNSESFKSD  240
EGSYEQRASS SIAPKAYEME GSCSSKINTT KNDTNLMSNC SNKDMFLDSY TTSCQPSDLM  300
GNYPLQITDT LPTNSNSCHW FSQTARPFDM NSEFTITSNV MSILPPTTTS FLPSTSFCYK  360
PSLGVPSEDI STASFALNGP NYWEASASNN SNGSNNTSDG SRELTTTSSK NSVLSSWGLT  420
EETKWSEYLQ NPMLMLAAPE SLCNQIRPAT HLVPDNTLGS IIVPDSKDQQ QQQQSQNSSI  480
FSKDTQKLTA AFGHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29921965108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191197LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.194390.0leaf| pod| seed coat| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973260.0BT097326.1 Soybean clone JCVI-FLGm-21J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242243.10.0MYB transcription factor MYB64
TrEMBLK7MZN60.0K7MZN6_SOYBN; Uncharacterized protein
STRINGGLYMA19G41010.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-93myb domain protein 55